ELFa(44 (4444L    /lib/ld-linux.so.2GNUCT 9L#M;>'26)H ,8K! QEJ%BP(- NSG=?RD<04 " .5&/7A@+:*CF3$1OIT px<,M<DLG\lDT(I|h%08CN̏$܏ ,[ 4,<ALxX\l0| (?9$̐ܐ  ,`d<X,0L3\lF|D$N0T:`h̑L9ܑ4(X4( Zr,,<4JLDm\l|b <!0l̒ ܒ(S8@<j  ,(< LLO\(zl| #T.x__gmon_start__libm.so.6logsqrtceilfloorldexpfmodatan2powlog10atanasinacosfrexplibc.so.6longjmp__strtod_internalstdoutungetcstrerror__ctype_bgetenvfscanffgetsmemcpytmpfilepclosesystemfeofremoveisatty__strtoul_internalfflush__ctype_toupperabortpopenrenamefprintfstrcatfseekmemchrstdinmktimeferrorstrstrsignalstrcollstrncpyrealloc_IO_getcmemcmpstrncatfreadlocaltimeftellsrandstrcmpsprintffclosedifftimesetlocalestderrstrftimefwrite__errno_locationexitfopen_setjmp_IO_stdin_usedgmtime__libc_start_mainstrlenclockstrchrfputs__ctype_tolowerstrpbrkfreeGLIBC_2.1GLIBC_2.0^0ii qii {ii {$Q(,&0'428D<E     $ (,048<@DHLPTX\`dhlp t!x"|#$%()*+,-./0134567ĸ8ȸ9̸:и;Ը<ظ=ܸ>?@ABCFGHIKL MNOPR S -L>4a- ( ( ( ( ( ( ( ( ( t( h( \( P( D( 8( ,( ( ( ( ' ' ' ' ' ' ' ' ' ' ' x' l' `' T' H' <' 0' $' ' ' ' & & & & & & & & & & |& p& d& X& L& @& 4& (& & & & % % % % % % % % % % % t% h% -- 0Yp - 0 0LS #8 0-X L0PSD0 R @000 0S000 -L -L@ 0? -L 00| -L0 0 0-LPP$@  00 0-LPP 8@wP(0( E0 -L@`p+Pfl `fPoW  0i`d@ܔ -L  -LP@`p1S 0g1-P1S8 0g0C1-@ -LP -0LyB p-LP$0`@v 0Bp 0-LPd@d qTPeL00D 0-LPQ D@;000@ /P [00,<@ p-L`VTTPT0JD@P,@,0V@epTLd` -LP 4@|(P Mh -AL@PP`PY0=S @R Gp @P @ "@7PT 0&B@P#x -1L p`,UPU"P+@@ 0P @P XUxPu `, p-LP@`T P fc0@-SL!iP cP3 P -P 5eP 2sP+ lP ,vP )0S&@.%00"] 0S@P P p0S@P 00p@1S 0-S aV 6D@Dw, app 0-<@L0PS !@0S00 -0LWP 0@S A4  0-L@MpP 00 R 0SL0 H0@@PK>@P0S @0 p-LP@ M!`Pi<$ K$P @ [@q!T0S Оp - LQ0d0Q Q,@a 060Qʁ010 -LQ 0 @ -L Q01 0C  P# -@00 0 L0b S 0 00 0-@0  BL1248 B! R 000b QS 0 R50 0-L@TP 01C0@  0 0 @T0 000 -0L(( -@0$ LQ:E  000 00 -0 @L1248@ 0-LQ !P 00\ *@ @ 0 0\: 0 10001 0  0 -L@=0 P*0 0 P:0 0C0 0-LP(Q 0 A0Q 000 0-LP@ 0 @D0 0 0C00 -L@00 0 00 -L0P0 -Lq 0$ -LP 0 S0 R   -L M@P 0S K'P @ -L@P -L0P 0SS00 p-L@P`VQ p p-L`@P0\0UP 0R ?)Ppp p-LP@`{ 0R0VP (pp -L MiP 0S K&P ꈁ -LX P 0S S0S   0-LPE@P00S0&P 0@@0$ Q:0 0-LP$@P00S0 0l&P0 -L P 0S0S  -LP 0S S -L P 0S  0-LP@P 00CS ꀩxxx000 - 0L 00 -L 0 00 -LP0p$ `P:d0@ 00 00 0-LP@Q0 0 p-L@0`$ PP:< ;p --@0$ LQ:, + -LP0@$ p\: @D` p0t1C0 01 @D0t  L N @ 0H0 00 -0 Q00L 00 - 000L 00 -L@ 0 Bn& 0 0 -L@ A^" 0 0 0-L@P"00 0 000 0-P0$ LQ:0@ 0Z!0 000 0-LP@P 0S S0PU 0< U0 0(0 000 -L@0@S0 R00 0 00 -L@0 C 0C&00C0 0-LP@ D! 0 @D0 00C00 p-LP`p @" 0 @D0 0 0C0p 0-L@] 0PS 0B080 R R 00P0 0C00 -L@B0 C 0@S0S@0 -L0 a -0L p-L@P`S M 0c ! ` 00b 0  K0l p 0-L@P. 0 0 000 0b S0  0  0 0b S0 C 00]0 -L0 M  K 0@00cG ꄰ 0-LP(@K0S 0Mw,b,P   0 -L@ 0 @S  04 0  -0 L  -0$L  -LQ: 0 5 00$ Q:@ -L -L -L@f  B;P 0 000 0C0 0-P0L$ @P:T0  B1248 B! B>&01 0C c 0T  @00'0 000 0-@0L$ PP:E 000 000 p-L@ 0 `0P c0RU 00 Q0 00p 0-L@P0S 0 R 0Tʄ01000<0 $0T1 0100 -L@0KMP 00 0 00 -L@0KMP  A  00  -0L  0 0   0c@@ -L@P0  P  0-P@(0LT (0@DT0200 -LRQ 40800<0 20 -L< -L0 -L4 -LQ (0\  0A0cLQ\Q(\Q0\0 `1248 !\  -0L0   -Lp@\0(0P`P ^  P 0 A  -LP@\0(0 p0`P 0C0 ;  P 0(S 01  0C  -L0S X0X  0  000 00<,P0 0 <  -LD0 RPEu 1eA` p  P 0S@DPEu 0-L@0P< << 00  <   0 0  -Lp@P`QW 0S0C"SN̻||||||||||||||||||d|||||ܻ| ||||||j(V  0  V PtP @00 80000 0S $ -L`p@M0P>S 0 pBS p 0~0p 0C0\0S  ( 0 0Ckp,KfzP 0 0b S0 00 -G0LS0 ,0R R 01?P - 01 L?0S :S S 0' -LG0QQ( 0AS  -LPM,0, 0 CP,X@ 0p!G"lV?(3  Q :Q# '3G"s T P " 0 P"3D?G@ (0T"34xB?7@d 0  0 V , 0S 01 ? R0J S񟗝(hX8,TWz , 0Z00VSrD0TS0 Qj G0 R0QaWT^0G 0S0 RG 0S{0 xJ,0Ru00SXG,0RBT 0G 0CSepGw P8W 0G 0CSU0 R'@DT$0G 0C00G 0SCx40T=0!D,0S6P 0  1?0SS,@P,0X 0  -L,  -LQ J01 RX -LpP0@0  @` AP3 ?0 S)XXXX XXXX<|0 ,30!h\0, QPD,4(,\$dl p-L@0`0S0P p@DT0   ?00CS! p -0 LS*Q 0S: -L@0P`t M 0 0qP K a1248Aa0S   p$t 0 -0S L p-L@`P$K MP@ p -LD0 0R$ R  0M$ -`@M@L0pPX@KD <   0p  -@XPLU `0pS N0  0 0 0 0b S 0 C 002 --L@  0-LP@AQhx @ 400 00  000(< -T0LS T70(j -L0M K0 0T0KT0 tP 0T0 -L,0 8S0 1 0C0 0(0a!"$(010 S] -LL0\0n!"$(0C1 0!  00n!"$(0C1 0! \(0\ n1248 B! 0n101248A010 \0  -L@`PQ0p  !Y 000H0C `0 -L@,pP(`, 0$ 0!1? ,P ET(-P f1248 ! ! ,0 40$ - 0LQʃ -@,0L8S,-0,08ST -L@`M0 00d -L@P <`0 Spb | yQ 0 A0 Q0 0b S 0  @  h -LP@0 Sb P0$ 0S0pW/ `F0S E O0G0a S 0   G00! 0p0 0S* 0 S:000 0bS 00 00 0 00  00  0  0C 0-L@0 Pc 0   00Cs00 0-L@P00 T 0A00 B 0  0 0 @T  0\:0@DS 0@DS0 p-L@P,0`#80P.0C4/0 ,0#8S=Si* P< ,0#80C.0C4/0$ 0R:pp 0-LP (0R0 a0  0 T@!B,C@D|T0  00 P m0 p-L`P0@0@0S 0 0b S0 00p p-@M (0L R 0  B1248 BQ "0  K\1`PP (  0.0/  E 1`p -L@P,0`#8 0$ 0  p0 0`S\ \0 0n0  0 10000 -LPMXp, X.@/(01 dcP @@  J(F4.`/0  01 0,0 X0 0-@0L$ PP: 0S  k P@  P 000 0b S0 000 -Lp @P$0KM( 4 K4 P0$`CP0P c.$0K 0 $0KXP   @ -L0 0 -L M K K -L M K -L M K -LM  K p-LPP `p @@ p 0-L@P, , 0 -LpP8@X`00000 `X 0-L@P0 0}0 -Lp`$P@T0@T -L`(@PvUpP@d0@S S  w} pPU4@PWU 0 PU 0-L@ PP`<?D2E/F,G)nX0 -L@ P?    }A h 0-L PK@ M  0  0 p-LP` 0F010@ 00`p -L`pP 10@ ~000p 0-L LPL@S PP 0S* 0 0 0 @000 0-L@LP 0 0 0 L0CL\ Q*0 0-LP H0_@ /00(0040 0,000$0D00E0F0G00800<0 00 0-LP0@, !;04 !50(  !.00 !(08  !!0$ !H 00 -0LS 00C001 0 p-L@8 ^0`S P0 Q@Tp ^0 Rp -L0 0 B0RpT00S00000P00@0 0-P0@LT 000@T0 -LM0(pK( @P T 0QP0`0l ^P0P000 `@p@T0 (0 0 -L 0 0R0C0 -Lp 00 S|00p %@ @T 0SkPvP 0  1 0   Y  00pZ@@Dt 0Q 0S00S; PE@Dt 0B@Dt 1da P 0S 0S00SY 0S00SZ`F@Dt p-P 0L @  (`T 0S0 000 (0@T$0@T 000$ @T40@T  00S40@T80@T 0 @  80 Tp -L`@pT 0PU7@0S00S @0PU00S 00S0PU0A R  0S00S000PU 0-L@ (P `1248 ,-0!Ā\,08S  b1248 0 RZS0 -L`@0pSD00SG( 0PR0 UP1R@ T *0S00S,0 @T:T0 0T -@0LS$ 00CS<(00}00: P00@000S -0LS 0000S0   -LpP  0RPEu 1ea0@P3`FPEupW -LpP% @@Dt 0a PP `F@Dt 0B@Dt 1da0P P`F@DtpW - 0L0CS"H0`<J 0[ 0 O 0 I -L@Pp`Q 0S@00P00Q p-L@ P0`U   00`0 0PUp p-LP0`\ BP@\ a0 @R@00 @ $00f 0p 0-P L0@0l \ 00  0 0P0 00O0 0-@1P 1 0 00 LR 00 00 0 00000 R01P 0C00 0-L@Q\P Nf F0 p-LP@80`S<00S,0S000SD8D0U 00Sp -LP0`K@M00@ (@ ,@ $@ 0 R$($p$@ (@ @D,($~$ 0-L@P_0 -0L 0   -LPp` @T@ ڡ?R0AR@0@ -L@Pp`ST @vd J@PU U  $00g$0$00$0$ -L P0 P -LP:P:

 00$00 0-LP@$ $0O0 0 0 0@ -L@ P 0p(M$P   ,P 4P 0P 8@ L`K $R{K;< 0}S# ~ [R 80R 0=S 2,P;P}{ 0(p0y H 1'890 14{   1#<00 1 p-L`@ 0P)S x0R FR `  Pg8V,P pX -L_nK`FP@p]MM5(P+ 20P! 0CP) 0CP# &0P "0P GP       -LPpM800S80@ @T  $ p. @T | 1 S8`K$ 1  @$0T 1 S800C80 -L  -LA@P,,,4444444444444,4444444444, 0-L@(KM$P fp0 -LQM$@$ 0S  0R 0R Q^ 0$ 00 -L`,M0p0CSj,QP H@KLPKL LH0S  4@K=E4@KPU $ 6$ 0 0U$0$ g a$ $0$  Be$ | 0-LP@F0S00$$ P0 -LuM $Pc pNK)1S01  K< 0 0`gdV@T}KsK0  11@T  pl' !r 00g01 !r 00g01 @TsK @(T<< 1 @ -L@(M$P`0pDK ZRE.00Kc  V 0-L@(PKM$(Pr0 -L@`Mp$P]<K &JW P0  0F@ W g  -LPM$` $p\ P =,,P `lp$@0 w$  L0LS 0~? -L` `P@M$4$ `$ `Sj110P pG @8  `W8  4@ 0$, 00pj`jW8! -L@Pp4K`MPD @KP? 0IS9O4OPOlOO00;00 400-00@&0D`0 Spb 8 00 @ P! 0P  -L8K MD 00 0D@ @0D``00  080 < 00@0 08  0PS8  800CS80  g 0 800C 0 00p%<  `?@q"TfQQRC0C 700a00%#\% P7 0Qʀ0A@01NC@D0S0 0  0S-0S 0 0 1  00 1 7;;Sʃ0@@01CL%3++Rʂ0A@`01NC@D0S0S0 07;;Sʃ0@01CL%3++Rʂ0A@01NC@D0S0S0 t 0u7;;Sʃ0@ 01CL%3++Rʂ0A@@01NC@D0S0S0H 0I7;;Sʃ0@01CL%3++Rʂ0A@01NC@D0S0S0@ 07;;Sʃ0@ 01CL%3++Rʂ01@@01>C0C v7;;0A R 4PK+P 00퀁@ 04 P 07;;01 P P0S 00 cG%#d@A0 `1 @ 0 $ 0Q:f7++Rʂ0!0@ 1.C B%3Qʁ01@@01>C0C 0R;;Sʃ0@p01CA++Rʂ0!@01.C B$P PSV7;;Sʃ0@01CA%3++Rʂ0!0@ 1.C B7;;Sʃ0@@01CA%3++Rʂ0!@`01.C B7;;01 P P0S %3;;R 00 80 #23?67;;S 010%3;;`CPP 0U80 0 00y 9V0  T 80 0 00L0 S`0q H0W*@0 0 @  0 ^:0100 0 0000 000A0  7++0R@C 01 0C0L0S  0080 0  0@ $CKK@DTn0  j `@0S D 0S `PX90S  @P0.QO%23?6"8 8 E%3;;PQ00 0 $0$@000 < 0 1pP0 P LI @0 PE0 Y 0S80080 80 ""#?&080 0S 0 0 D@500 %23?6l!8 8 0S m%#?T0@   g1248 B!0@B0Tڄ !0`P  W0 PE@D0T `Fʵ-%34<@?7 PA<D  U @"@800? R06<0 01|!!!!P80 U080 0 $ 0Qu:6r -L@M  K P 0S0C0   -@0LSp 0 0 B0 0 -L00 00 -Lp`RP 0S p0 0 B0 @V@1 p`V0 0d 0  0-L@0PUUP P 0!0 0-LM0^0! P@B ?0S@0" \0\ 0CQ(0)7  000 0CJ0 0-L@ ,0M P I K 0 -L@M, p-L B`a?&?CS0Q @ (y$ 0 3p!? -0L0 -L0 $0  !3p  -0L Q0?0  @x p-L@tP` ?0S 3;;S p@tp -LQ 004<0 -L@tPp $ ` ?0S  p"3;;S  d  ]@t -L@ M 0  0 0 - M0LR0   0-L@PT  0 p-L`vP0 q`p@@Cp p 0-LP0$ G@TT 0G@0" 0-L@P$00$00 -L4 Q00Q0S $00C$0 -0L S -Lp@M`0Sp%P(0( 0S t0t( 0 0Y(0 01  00( !(00(0(" -L0 K M0  -L0K M0    -L0 M$0  0K$ K0 -L@0 SQ  < 1#<00 1 00 1#<0 0-L@M0P0CS)llllmmmm 0000 z DA a 00 0 -LP`p@MB 0@I p-L@P`M00C S3mmmmdndndndndn n0n $ 0S00!0 '0 !04<0 0V    0Hp 0-LP0@ S $  B0 -L`Pp M0 S  0Q3  PP 0@ S @ 0o 0iV@ 0 0 0 00 0 0-L@Pj$  B0 0-LP@0 S 0R0 40R00 - 0LR  0-LP@0S S (00 S  0 00 P0 p-L@PM0`0CS'qqqq" A 0* 0- p -L@PpMw$` 0  0H -L4!  <0 p-LP@M0` S  0? R  V00007L 0 `p 0-LP@)00CSssssssss ]  <0 0-LP@00CSdtltdttttttxt 6   0 0-LP@M00C S!uuuu\u\u\u\uu u u00_N8 0I 00 0 0 0 -L@00 0-LQ@PM&0S0 01 0Rခ-Q0  000 0-L QP@ Q  Q 4 0 00Q000:0p0 p-LP^`M@  @ 0 ^0P@ ^  0N@0 00@"p -L Z`pM Z# W Z T B00  00 X 200  00  H 0 S 1?0S_  x 1'890 1 00(IF0 V 00P@/, 0@` -L 0 1 -LP`pM@0, 0S ,   t0  a00 0S 0  ,0t q000X" -Ĺnj 0  -L   -L`PU o[UU ~U Ge,0  BQ  , 00,-P -p,0  BQ  , 00,[P,0  BQ  , 00,[P0 Ss ,0  BQ  , 00, Pp,0  BQ  , 00,{[Q[4p,0  BQ  , 00,c=P =p,0  BQ  , 00,PLp,0  BQ  , 00,?=P <p,0  BQ  , 00,,p,0  BQ  , 00,=P >p,0  BQ  , 00,4p,0  BQ  , 00,=P ~p,0  BQ  , 00,Gp |p,0  BQ  , 00,.P$,0  BQ  , 00,.P,0  BQ  , 00,Fpp 00 .Z  ppp0 04 ,0  BQ  , 00,}8  _UD 00(0S  ppp (`  T,0  BQ  , 00,Dp$$ -L`Pp|@K dMW8 t,^P `Vx 0Q $$$x0S0x0 px0  C$$ p-L@`P{0 p % 0-L@Po 0 0-L@tPK `M P $ P`0S T K %$% ,%0 -p-L@`P p p-L@P1`S Pp@1Sp -LP`}p P@jk^b -L@Q p-L@`PP XP ᐾP^pWp 0-L@PP q00% p-L`P@P  7p 0-L@Pp 0D% -LP@`KpP V a -Lp`@PyP U T ᶾ  0-LP@-P 넁0 -Lp`P@IP0- p-L@PgP `&-PP pp p-L@PX` 0 S@ P  p' -L`PQM bpP@PB0S0h,0  >XpP@e@T `i$0S,0CO -LPp`HpATP@9 -LPp `P@%~!D 8 m T%\% -LP@p 0 SP` TP  q-9q-'$ p-L@ P0S`` xh@P!x  Z@Pp@@ PDp'$ 0-P0L 0C S @>0@0000 -0LS `pP U00@ f R0S PJ`Vd00f00 -L@P   -LpPBu@ j `0S:PE 0u0  0-LP@ؼ 0 -L@)00 -L@`WpP0g: 0U , ټ000iP +000s -L 0 0  p-L@ P0S@`?Pp 9paV  , P``  p' p-L@P`Rd 0S@  }a-: tp' p-LP`ᘻP p@0*0S0p p-L@`PȻ徻0 S}p`% -L`@MMATp 8 010 0K  4?1 KP 0KPB N KS0 0帀4   0K0P !P K( t@0 PC:0l P K 0K 0@R T   t%<|%%8% -LP 00 -LM   KwH 0-LQP tp1P 000@ 㯿0%0% 0-LP@Q 0@0 -L@> -L@ 0-LP@2 00 -L@ipGW" ƿÿ  `PdWTPPpKW0 %%,%% p-L@C/ MNpQ U㾿P; *-5 0E"S` K 0V l0 00 0 0 RP -$@%8Ap 0-L@t pQP U1*0? -L@TP  Y% 0-LP@ \TT H X< P ,㐾0%% & p-L@`MPھ* pQUp +x`K PH  < ɾP  ?0&L&\&`&p 0-L@P( ᪾P0& -L@P. -L@ P Es㥾P 4W#P(&& -L@ 㩾# -L@ = -L@  -L@-o-h -L@ p -L@fl -L@ F㊽P* -L@ 2, 2$Կͽ' -L@-f Ľp4 ,᱿㪽 'A-t!㢽P -L@Q о^ 0-L@ KMP 00 00 -L@ 0 p-LP 0@`P  ׼fp -L@0P Լ  '' p-L` yP0 @bT "@Tp,' -L@lᖼ@ 0PҾϼᇼ -L@T㊼ 0ȿPᶾɼk 0-LPM7$!PPҼPFPر,9㯼6cP0,@KϽ |@KȽ d @K⣽ L@K⮽ 4; $ D'X'P'`'l'|'''K0 0-L@M!P. qPU ჾ[3ԾP㋾P XOPU( v޾0' p-L@T`᥽LPŻU0Ppp'' p-L@0`Sp;S@;¶PPVP a]p -LP@p T p; aI@?㞶`PVጿ' -Lp` Hp0C(ỽӻP @㹻ẽkP tpWC@PW W> I`A HQႽf㈻] RSM߽zPBUa^ڽ @0L @0 ''($(P( p-L`P@lP ᅺ6Pᶺ@XP8 qp kp*8* 0-L@&PPh \ᑺ @PPμ@dʺ0żº0T* 0-LPl@p @PP y㥺x\0 0-L@>PǺP׺P (  㫺 0h* -L@  Dܸ -L@( 0-L@`M⪻PP\ TH ۻt K8P P ̻T***  Ļ*0 p-L@ 㹻W 0\ 㭻 㩻Pż 㡻e`<߼d 㔻X 㐻᭼@ ӻᦼ᣼p*p(*+++$+ -L@<< 03,჻u(+*' 0-L@Pqnr0 0-L@PdQ-;c0 p-LP0 "`Mf` P wpx@K ፾P ѹP !} Q`㱹x KḿPL!gɻ0Sa @0S0C"SXꌾdddddddddddddddddd<dddddȾdddddddԾh txX Kpp\ ydl  \d T` oDt ]8p Y4+@+<+\+l+t+++++++0 㧺E0S+p 0-L@`MptPK P< p!Pg+ᐺ0 0-L@`MptPK ȽP kp!p P+0 p-L@` pQ>P pV   (Q C@d⢸p -L -L@" 0-LP@喺᯺㶸Pd 0Q- i000++ p-LP`c>@P@r90P@l30P@Vp -L   c00 r00  l00 00 p-L`aP 0 Ph  pA 80Լ0+᧺p+ 0-L@MҼPʼP 0P   n,LD KxẼ-M+0 -LPGOKddpd`M3 +P <᮲P w(,0<4, -L`P`M\ P|!Px X L pKbX V  lP`F  `  _PJ  ᝽`@K &l Rڬ x 0f0CS l| t00mSLtSCS0 ĸ<,@,D,X,`,d,h,l,p,,,Td0 ` P۶, -L@<< 0A0 㒸$ ظ᜹ -,\-0 0-LQ@P 0bU 0H ᧸ ,៸ 01-S0h-p- p-LP@ `P Lpt-|- -L@P P) 0S$ 6 1t--- 0-LP@0S 0- 0-L@㙺P00U0t- p-LP@`V@ 㙶p p-L`0 @T p0 T d0 TpPmpPPU ~00p<,0 0-L@op DPiP0ηW '0- -L@H0S  0-LPM:0S  0 K!4K! 0KK -@K4 ӱ ᵷ--0 -L` pD 0@HP᪱Q - -L` ipD 0x@*PQ - 0-LP@ᳰQ 0 -L@>Ƿ -LPpĵP*{`%V @LP垰0h 3a ㌵(ᇷh- -  L-- -  L-- p-L@P`< ö4e^6 pt- -L@  p-L`OPʐᴶ=p @pPTҰP.$ ᴴ p-- 0-LP KM0@T -KW0 p-L@PṰ`ᾯ Rp -LpP @BM M`P1@ #PWP#0 S R K000 K0 A0 K0< -LPj@ $BM Mcp0$CV`! 0ϯ$ K0PU00  P@ K$@ @U zP @ -L@pQ`f `!Hx] {P^p! p!!"RZB>PP 0*S !0a0CS(7 ghX w`Hx PP㯳Uj-A..4. -L@1 p- -L@# d p-L@t`PU`PP p<፴P rͳ8pD. -L@pMSP`@v) ųPU U- 腮PP\.$ K0U $ 0P$0P00P@`Fv f -L@ - -L@  -L@p 0DP upah `0!ᏮPc-蟴 .p..d. -L@ l&P - -L@[P  -L@@8 v㐵 0t-/T/ -L@ x-O 0-LP i@P 0 0-L@ YP TቭP 0 - L/ -L@ ;릭8 -L@ᰭA-逄.A 0-L@P Q-0 0-L@Pq0 p-L@`|>P$p -L@pPi`᧲Pu, 5 pQ/ -L@0!AM`.  p1s 1 ㉭  0!SK׭P`K PUᄳQ0* C*S0t CtS R+R z v r n  i v. c  ^ p Yh dGK 0$P8/00 000 0(00080@0_ 0-LP,MP-)@ +o H@  C<  >8 @x 84 h 30@X 00 -v>@ 0CD,0  @Kq  00 000 080-0 0-LP1, pAAp-Ҳ0 p-L@>`x 0pJVPtPH u4 ,0Y˲p0p00.X0 -L pҬ -L@ 0B3`` 08X XX0{L LL0u<0< 0o101.1<-1,-01 -L@ခ -W -L@-賬-H -L@-萫-9 -L@-Q-* -L@t-被- -L@e-[-  -L@V-p- p-L`G-0B- -p -L@1-S-ر -L@"-ث-ɱ p-L`-0- N-賱p -L@뀑@ -ϫ-蠱 p-L`-0- E-花p -L@--{ -L@--l -L@-x-] -L@@-OFߑ?9R -L@-?Fߑ?9R -L@M- Kת-,01-& p-L`p-0kp!-p p-LP-J`W@TPN@T- p p-LP--`:@T3@T-ذ p -LP-> EAA @T T 7T 4-躰7paV aA-赪p10papqVX 0f01A-蜪p101-芰A11  -Lp -L@hh 0#\ tTe~< i0 㯰(s03183! @-DT<3D p-L@ M` EPUQ-3  㮱PpPUp 0-L@  PUP 㲮ᯮᬮ 㳮PB0 -L@ g- -L@ (p! -LP p C@W` paV@p  n @DTQ ߰ -L` pq- pQW G @U @ 9 ᴰPUg ᫰ -LJK$@D@D`0!MM pQ pq TWpK$A AU +Ph <JK$@D @DcU  /PU K$@ @KD3?H3 0-L@0P L H0 p-LP@`ửP 6p㣭D⠭F❭ pN@4p -LpP0?` ᕯ ᑯ P    P  T{  kU@H c `@DVڔ` N PTDά@D : mPT W㹬 & "  G g0fR@`Fp@`D kW   8P  $ㆬ0gS@Vd3 0-L@ 2PL (ڬP !e .0D3 -L 043 -L@ KM 01S-A -LP p-LP KM`.p@P ;pT0@P  TA d ͭ  ƭ4p -LJK @D@DP MMp B0`V*Pdp K0S:0 C 0K 1`0 0KV: K @ @( -LJK @D@DP MMp B0`V*Pdp K0S:0 Ca 0K 1`0 0KV: K @ @4 -LZKPEPE@ MMfppaKA A K@ @ :0`FS K@ @U 0-L@ KMCP0 p'P0P ?0S-0 -LpM M?K A AY`VDpQ0S X P@ K0S0 C:` K0VP0 K @ @ 4 -L 0-LP M MJK@D @D( ὮP*t040 -L1QJ 0P0!rP4 - LPJ1s PZh4 0-L@0P%S [S 0Sd0 ^R@0S<0%S0 R@0]S0044 -L0 S*1 10a0CSc$ 4$$$$$$$X$$$|$$$$$`00 0$ D<1 ?(00 0$ 600 0$ -0 (00 0$ 00 0$ 0 p00 0$ \@0 ^0  P(8 -L@pP0`^SpG@0%SgP 0-S 0S*@0TS0U0S @T:' -L0.S %S [S  :  B P p-LP@0`S 0Sl 0R p@ T *0SQp S@T:p4 -L@pP`@ 0S* PT kP@TZ -L`@pP ZP 0T* P@ -L@` PpUD0 `0 p 04P 00C 04 -L@P`hq @0 0c0P00 p-L@`@ 0P0fS:0 Ppp -Lp`@0)S񟗃dlp \0)S 0v 0p 0bS f\ & `P@0[S  0V VPH P P @!00   e`P @0SV 0PV* P 0*0CS0Tl,R@K  APD 0R  0R `@.48 -L`PpS WDpGPg @ P 0fPc`U  ᚣ@P p-@a0PLuLFu 0  b-ép0 ȩp5 p-P@`t  L 0T0RQ  a఩p@T 0@T p4 -LpO/KGM-KPS/ <p@P@CJ<1T@!ۨ`P QP <@1di@PJ @i01-a@1@AT,-W:0^SP0D1 0i01-G0i1-A   Da <1@0q 8 041 NoK?$5AD1S  , HP 41@R: -L`@M⇨ᤨ@|l@0a 8 4A Sp0hU01- Ꭷ 1A p!41@T NK , PP41@T -L@   Ῠ X -L@`PpឧP. `9P U9*z p0%SP 00  0S: 00  P U:#  _P 㲦8 -L!LK(@D @Dp !M$MyP t001SD- 0p^S00*KL1yP &PP  2!K(AA0 X0q 8Q 041 /NoK 0,1 9@P !K(AA 0TTTPA0541U*@( K0S0(C:(0K 00(0K *KL!R X!LK(@D@D4! a ᐁ-ݧ p-LP KM`: 0R:"  0*0"S S S \SJ0 @S: \00R  L5: 0R: 00 0`0Cs0 : 0R: "00 p -Lp@M, P`T58@ݠP00 0 @00 0 @0.S@ 02 0 @00 0 @000  L Pg0S4 %0, 0䈡, 0\55 -L"LK(@D$@Dp  "M0MG`K(A A0*K0X2{:KX2V*"K(H HK(I I0%S0%SB( K0S0(C:(0K 00(0K " >> near `'return %s=stdinprinterror calling `print' (%s) =option `-c' is deprecatedoption `-s' is deprecatedargLUA_INIT=LUA_INITcannot create state: not enough memory$Lua: Lua 5.0.2 Copyright (C) 1994-2004 Tecgraf, PUC-Rio $ $Authors: R. Ierusalimschy, L. H. de Figueiredo & W. Celes $ $URL: www.lua.org $ no value?Lua 5.0.2=[C]CmainLuatail=(tail call)globalvalue for `lua_getinfo' is not a function?localfieldmethodattempt to %s %s `%s' (a %s value)attempt to %s a %s valueconcatenateperform arithmetic onattempt to compare two %s valuesattempt to compare %s with %s%s:%d: %snot enough memoryerror in error handlingstack overflowncallC stack overflowcannot resume dead coroutinecannot resume non-suspended coroutineattempt to yield across metamethod/C-call boundarycannot yield a C functionLuamemory allocation error: block too big%... [string ""]$a $ a4A 488888$$4!`%s' expected`%s' expected (to close `%s' at line %d) expectedlocal variablesupvaluesparametersargconstant table overflow expecteditems in a constructor or `...' expectedselfambiguous syntax (function call x new statement)function arguments expectedunexpected symbol too many syntax levelssyntax error`while' condition too complex(for limit)(for step)(for generator)(for state)`=' or `in' expectedno loop to breaknot enough memoryinvalid key for `next'table overflowtable index is niltable index is NaNtld\PtHthreadfunctiontablestringnumberuserdatabooleannil@4,$ __call__concat__le__lt__unm__pow__div__mul__sub__add__eq__mode__gc__newindex__indexunexpected end of file in %sbad integer in %sbad nupvalues in %s: read %d; expected %dbad constant type (%d) in %sbad code in %sLuabad signature in %svirtual machine mismatch in %s: size of %s is %d but read %d%s too new: read version %d.%d; expected at most %d.%d%s too old: read version %d.%d; expected at least %d.%dintsize_tInstructionOPABCnumberunknown number format in %sbinary string%.14gindexloop in gettableloop in settablestring size overflow`__pow' (`^' operator) is not a function`for' initial value must be a number`for' limit must be a number`for' step must be a numbernextcontrol structure too longfunction or expression too complexconstant table overflowcode size overflow######|#x#l#h#d#\#X#T#P#H#@#8#0#(# #### ####"""*string*number~=<=>===.....*namewhileuntiltruethenreturnrepeatornotnillocaliniffunctionforfalseendelseifelsedobreakandtoo many %s (limit=%d)%s:%d: %s near `%s'%clines in a chunkambiguous syntax (decimal point x string concatenation)malformed numberunfinished long stringunfinished long commentunfinished stringescape sequence too largeinvalid control charchar(%d)nmethodcalling `%s' on bad self (%s)?bad argument #%d to `%s' (%s)%s expected, got %sSnl%s:%d: stack overflow (%s)value expected__modekcannot read %s: %s=stdin@%srrb_ALERT%s tostring`tostring' must return a string to `print' base out of range__metatablenil or table expectedcannot change a protected metatablelevel must be non-negativeinvalid levelfno function environment for tail call at level %d__fenv`setfenv' cannot change a protected environment`setfenv' cannot change environment of given functionnextipairs%sassertion failed!table too big to unpack__tostringtruefalsetable: %pfunction: %puserdata: %pthread: %pnilboolean or proxy expectedLUA_PATH?;?.luatoo many marks in a path component_LOADED`_LOADED' is not a table_REQUIREDNAMEcould not load package `%s' from path `%s'error loading package `%s' (%s)*P*)<) )D' 'P)))%)`)l)د) )T))H)p)$h)ث\)ĮT)H)h@)requireloadstringdofileloadfilegcinfocollectgarbagexpcallpcallrawsetrawgetrawequalunpackasserttypetonumberprintpairssetfenvgetfenvsetmetatablegetmetatableerrortoo many arguments to resumetoo many results to resumecoroutine expectedLua function expectedrunningdeadsuspended*d*ܹ*D* *0statusyieldresumewrapcreate_G_VERSIONLua 5.0.2newproxy__modekcoroutineflnSu>%sfunction or level expectedinvalid optionsourceshort_srclinedefinedwhatcurrentlinenupsnamenamewhatfunclevel out of rangeh,,,++tail returncountlinereturncallexternal hooklua_debug> cont stack traceback: ... Snl%s:%d: in function `%s' in main chunk ? in function <%s:%d>P-H-@-4-X,- - -p --0tracebackdebugsetupvaluesetlocalsethookgetupvaluegethookgetinfogetlocal_TRACEBACK%s: %s%sFILE*bad fileclosed filefileattempt to use a closed file_outputclosed%pfile (%s)r_inputw%lftoo many argumentsinvalid optionobsolete option `*w' to `read'invalid formatfile is already closed%.14g...endcursetinvalid modeL/pD/0 H( Q( Y( bD( mlX x4 | t4 L   d \   H (  $  &  6 D SLT _t n  xl d H  `   T XTl   X @  `< 0 0 # /D =  F0 Q(, [T qX ~0\ X H ,( T lL <  <  p 8 8h   * 4<P ?  EDP P@ [ ` il x( P    8 X        D  < $< 8`(  << x @ +TD 0 :\ E8 J R   Y, a@ i@ yD T  h d dd   dh P! P! d!  ! ! `"T "p $$d %$ 1@& =& G' O) X) `+P k`+ v- - X/l / 0 h2L 3 4d h7 l8 l8( 8d 8,  $9X  |9  :L # L:$ , p:$ 7 :\ B :T K D; V ;T ` 0< m <0 { = >d 4?T ? A$ A B( C TD E E G \H  I  It  J . N 4 b ; d C e, Q et ^ `fL k fH z fx lg8 g hh8 i< j$ @j k< m@ Tm hn@  n4  r4  r % t - @"5 w ? z F l"|S { ^ |X l }t z H~ 0 LP H  0 ęT  P  \ HT H0   L@     $ P 2 P = X O < a Ԩ i T u 8 D H T< H ثL $< `D P \ P 08 h\  Į< ' l 3 ll ? دp K H` V p b  p  ~ x h | | p(  D ܸ dx ܹ0 $ 0 *0 &p /p4 8< A I R  [ fX qp( |++ Dd `    0@ ,P  D t 8< tH h $ t $D4 *x 6x >x G@ R@4 \t ep$ n$ xh   0 P T hD   L `0 , T @0 p, d.p. t< 8 '.`-T/H2d =L< H@ RX \   g@4 qt@ z< 4 $H l  P (\ X0p0 <0 0`4 44 h< < < < )X< 3< =X H(< Rd< ]X fL pDX y< < < P@ @ \ ,T t t h\ $ 1  H D #<@ -| :@ GP R`8 W a, i s3H} X        t |  L XH  P h )t : G8 RPl Xd c| qT }d  P  d X  xl P 4$ X D  \   5h D P @ * 0 8   *x 0 8  *  0  84 >DQ \ iL xh H)` ܣX H ,  t < X p, PdH !} /DH <x<Y,kk  <Dd h L\, p   lD A  < (|X 1(LlH _|h%ot y \ ,   ` L 4  x ph pd )Df 7oH Hp@ X@c|s qP zT4 00%d T 8̏X ` Ģ4 &X K&l_&PH m&̤0 z&$ &حX &|&8 &&L &H & & &DH 'w '0 ' ''T7'xgcc2_compiled.call_gmon_startcrtstuff.c__do_global_ctors_aux__CTOR_END__init_dummyforce_to_data__DTOR_END__p.3__DTOR_LIST__completed.4__do_global_dtors_auxfini_dummy__CTOR_LIST__lua.cLprognamelualibslstoplactionprint_usagel_messagereportlcallprint_versiongetargsdocallfile_inputdostringload_filebuffer.147readlineget_promptincompleteload_stringmanual_inputhandle_argvopenstdlibshandle_luainitpmainlapi.cnegindexluaA_indexluaA_indexAcceptablef_callf_Ccallaux_upvalueldebug.ccurrentpccurrentlinegetluaprotofuncinfotravglobalsinfo_tailcallauxgetinfogetfuncnameprecheckcheckopenopcheckRKluaG_symbexecknamegetobjnameisinstackaddinfoldo.cseterrorobjrestore_stack_limitcorrectstackluaD_growCIadjust_varargstryfuncTMcallrethooksresumeresume_errorf_parserldump.cDumpBlockDumpByteDumpIntDumpSizeDumpNumberDumpStringDumpCodeDumpLocalsDumpLinesDumpUpvaluesDumpConstantsDumpFunctionDumpHeaderlfunc.clgc.creallymarkobjectmarktmuremovekeytraversetabletraverseprototraverseclosurecheckstacksizestraversestackpropagatemarksvalismarkedcleartablekeyscleartablevaluesfreeobjsweeplistsweepstringscheckSizesdo1gcTMmarkrootmarklmem.clobject.clog_8.81pushstrlopcodes.clparser.cnextlookaheaderror_expectedtestnextcheckcheck_matchstr_checknameinit_expcodestringchecknameluaI_registerlocalvarnew_localvaradjustlocalvarsremovevarsnew_localvarstrcreate_localindexupvaluesearchvarmarkupvalsinglevarauxsinglevaradjust_assigncode_paramsenterblockleaveblockpushclosureopen_funcclose_funcchunkluaY_fieldluaY_indexexprrecfieldcloselistfieldlastlistfieldlistfieldconstructorparlistbodyexplist1funcargsprefixexpprimaryexpsimpleexpgetunoprgetbinoprprioritysubexprblock_followblockcheck_conflictassignmentcondwhilestatrepeatstatexp1forbodyfornumforlistforstattest_then_blockifstatlocalfunclocalstatfuncnamefuncstatexprstatretstatbreakstatstatementlstate.cdefault_panicmallocstatefreestatestack_initfreestackf_luaopenpreinit_stateclose_statecallallgcTMlstring.cnewlstrltable.chashnumarrayindexluaH_indexcomputesizesnumusesetarrayvectorsetnodevectorresizerehashnewkeyluaH_getanyltm.cluaT_eventname.39lundump.cunexpectedEOZezgetcezreadLoadBlockLoadVectorLoadIntLoadSizeLoadNumberLoadStringLoadCodeLoadLocalsLoadLinesLoadUpvaluesLoadConstantsLoadFunctionLoadSignatureTestSizeLoadHeaderLoadChunklvm.ctraceexeccallTMrescallTMluaV_indexluaV_getnotablecall_binTMget_compTMcall_orderTMluaV_strcmpluaV_lessequalArithlzio.clcode.cluaK_condjumpluaK_fixjumpluaK_getjumpgetjumpcontrolneed_valuepatchtestregluaK_patchlistauxluaK_dischargejpcfreeregfreeexpaddknil_constantcode_labeldischarge2regdischarge2anyregluaK_exp2reginvertjumpjumponcondcodenotops.162codebinopllex.ctoken2stringluaX_errorluaX_lexerrorinclinenumberreadnameread_numeralread_long_stringread_stringlauxlib.ctag_errorcheckintgetsizesemptybufferadjuststackgetFerrfilegetScallalertaux_dolbaselib.cluaB_printluaB_tonumberluaB_errorluaB_getmetatableluaB_setmetatablegetfuncaux_getfenvluaB_getfenvluaB_setfenvluaB_rawequalluaB_rawgetluaB_rawsetluaB_gcinfoluaB_collectgarbageluaB_typeluaB_nextluaB_pairsluaB_ipairsload_auxluaB_loadstringluaB_loadfileluaB_dofileluaB_assertluaB_unpackluaB_pcallluaB_xpcallluaB_tostringluaB_newproxygetpathpushnextpathpushcomposenameluaB_requirebase_funcsauxresumeluaB_coresumeluaB_auxwrapluaB_cocreateluaB_cowrapluaB_yieldluaB_costatusco_funcsbase_openldblib.csettabsssettabsigetinfogetlocalsetlocalauxupvaluegetupvaluesetupvalueKEY_HOOKhooknames.126hookfmakemaskunmakemasksethookgethookdebugerrorfbdblibliolib.cpushresulttopfileio_typetofilenewfileregisterfileaux_closeio_closeio_gcio_tostringio_openio_popenio_tmpfilegetiofileg_iofileio_inputio_outputaux_linesio_readlinef_linesio_linesread_numbertest_eofread_lineread_charsg_readio_readf_readg_writeio_writef_writemode.195modenames.196f_seekio_flushf_flushiolibflibcreatemetaio_executeio_removeio_renameio_tmpnameio_getenvio_clocksetfieldsetboolfieldgetboolfieldgetfieldio_dateio_timeio_difftimecat.248catnames.249io_setlocio_exitsysliblmathlib.cmath_absmath_sinmath_cosmath_tanmath_asinmath_acosmath_atanmath_atan2math_ceilmath_floormath_modmath_sqrtmath_powmath_logmath_log10math_expmath_degmath_radmath_frexpmath_ldexpmath_minmath_maxmath_randommath_randomseedmathlibltablib.cluaB_foreachiluaB_foreachluaB_getnluaB_setnluaB_tinsertluaB_tremovestr_concatset2sort_compauxsortluaB_sorttab_funcslstrlib.cstr_lenposrelatstr_substr_lowerstr_upperstr_repstr_bytestr_charwriterstr_dumpcheck_capturecapture_to_closeluaI_classendmatch_classmatchbracketclassluaI_singlematchmatchbalancemax_expandmatchmin_expandstart_captureend_capturematch_capturelmemfindpush_onecapturepush_capturesstr_findgfind_auxgfindadd_sstr_gsubluaI_addquotedscanformatstr_formatstrlibloadlib.cloadlibLdiv0Lgot_resultLoop1LbignumLoop3*ABS*__dso_handlelua_resumeluaM_realloclua_getupvalueluaF_closeluaS_newudatalua_insertlua_touserdatalua_pushlightuserdatacos@@GLIBC_2.0luaD_rawrunprotectedluaC_collectgarbagelua_atpanicluaK_exp2valluaZ_openspaceluaX_setinputlua_isnumber__strtod_internal@@GLIBC_2.0rename@@GLIBC_2.0luaK_setcallreturnsluaD_callferror@@GLIBC_2.0luaK_nilluaL_refstrncat@@GLIBC_2.0strchr@@GLIBC_2.0luaL_openlibluaK_exp2RKluaO_pushfstringfeof@@GLIBC_2.0luaU_endiannesslua_sethooklua_load__ctype_tolower@@GLIBC_2.0lua_setgcthresholdatan@@GLIBC_2.0lua_pcallluaF_freeprotoluaL_addlstringluaopen_stringluaF_findupvalungetc@@GLIBC_2.0_DYNAMICluaF_newLclosurelua_gethookmasklua_concatluaL_callmetaluaopen_debugluaG_ordererrorluaK_getlabelluaK_exp2nextreglua_tocfunction_bss_end__luaK_goiftruelua_nextluaO_int2fblocaltime@@GLIBC_2.0luaE_newthreadlua_strlenstrcmp@@GLIBC_2.0log10@@GLIBC_2.0asin@@GLIBC_2.0lua_newtableluaL_unreflua_gettopluaK_dischargevarslua_pushvfstringfprintf@@GLIBC_2.0tmpfile@@GLIBC_2.1luaS_newlstrgetenv@@GLIBC_2.0luaO_str2dsignal@@GLIBC_2.0fmod@@GLIBC_2.0lua_tothreadluaK_exp2anyregfflush@@GLIBC_2.0pclose@@GLIBC_2.1luaL_checkstackluaK_storevarlua_getmetatablelua_dobufferluaL_checklstringclock@@GLIBC_2.0lua_pushnumberfrexp@@GLIBC_2.0luaC_sweepluaV_concatluaV_settable__udivsi3lua_removelua_gethookcountluaV_lessthanluaF_freeclosureluaK_goiffalseluaK_indexedluaZ_readluaL_loadbufferlua_getgcthresholdstrerror@@GLIBC_2.0__bss_start__luaX_errorlinelua_tostringlua_pushlstringluaZ_fillluaG_inithookslua_isstringluaD_callhooksetlocale@@GLIBC_2.0lua_pushvalueluaV_tonumberluaT_gettmbyobjluaV_equalvallua_getinfoluaK_patchlistlua_pushnil__errno_location@@GLIBC_2.0pow@@GLIBC_2.0luaH_getnumluaL_errormemchr@@GLIBC_2.0lua_tonumberftell@@GLIBC_2.0luaT_gettmlua_settoplua_pushcclosuresystem@@GLIBC_2.0luaL_getmetafieldluaX_checklimitlua_versionlua_pushfstringluaL_checknumber_initpopen@@GLIBC_2.1luaU_dumpdifftime@@GLIBC_2.0lua_dostringlua_openluaL_checkanylua_setlocallua_typefscanf@@GLIBC_2.0lua_iscfunctionstrftime@@GLIBC_2.0luaV_executefread@@GLIBC_2.0lua_pushbooleanremove@@GLIBC_2.0luaO_chunkidluaL_buffinitstrpbrk@@GLIBC_2.0lua_xmoveluaH_getstrstdout@@GLIBC_2.0__umodsi3lua_settablestderr@@GLIBC_2.0luaS_freeallluaK_jumpabort@@GLIBC_2.0luaK_infixluaF_getlocalnameluaU_undumpluaL_whereluaL_pushresultluaX_initlua_setmetatableluaL_findstringluaD_precallfseek@@GLIBC_2.0lua_topointer__bss_end__lua_closelua_rawsetilua_rawgettime@@GLIBC_2.0luaZ_lookaheadmktime@@GLIBC_2.0luaH_next_startfgets@@GLIBC_2.0luaD_protectedparserlua_dumpluaL_optlstringluaL_newmetatableluaD_throwfputs@@GLIBC_2.0luaO_pushvfstringstrstr@@GLIBC_2.0strlen@@GLIBC_2.0longjmp@@GLIBC_2.0lua_newuserdataluaD_poscallluaD_reallocstacklua_pushupvaluesluaT_initluaA_pushobjectluaH_newlua_lessthanatan2@@GLIBC_2.0luaF_newproto__ctype_toupper@@GLIBC_2.0luaF_newCclosureluaH_setluaK_codeABCluaV_gettableluaO_rawequalObjlua_yieldlua_identluaK_numberKluaK_patchtohereluaK_checkstacklua_callfloor@@GLIBC_2.0memcmp@@GLIBC_2.0__bss_startluaD_reallocCIluaV_tostringmainluaC_separateudata__div0luaopen_iolua_errorluaL_addstring__libc_start_main@@GLIBC_2.0luaG_concaterrorluaG_checkcodeluaM_growauxexp@@GLIBC_2.0luaL_getmetatable__end__luaO_log2luaD_pcallrealloc@@GLIBC_2.0strcat@@GLIBC_2.0luaC_callGCTMlua_checkstacklua_equalluaK_prefixlua_gettabletan@@GLIBC_2.0data_startluaL_addvaluelua_pushstringluaG_errormsgluaH_freeluaL_argerror_finimemcpy@@GLIBC_2.0sqrt@@GLIBC_2.0luaS_resizeluaG_runerrorfclose@@GLIBC_2.1luaK_fixlineluaT_typenameslua_gethookluaK_stringKsrand@@GLIBC_2.0strcoll@@GLIBC_2.0lua_cpcalllua_getstackluaopen_baseluaY_parserluaK_reserveregsluaopen_tableluaP_opmodesluaK_codeABxexit@@GLIBC_2.0luaH_getluaK_selflua_getgccountluaG_aritherrorgmtime@@GLIBC_2.0lua_replace_edata_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endluaH_mainpositionluaX_syntaxerrorlua_newthreadluaL_checkudataluaH_setnumlua_setfenvluaX_token2strisatty@@GLIBC_2.0lua_setupvalueluaG_typeerroracos@@GLIBC_2.0__ctype_b@@GLIBC_2.0luaL_getnluaL_setnluaE_freethreadstdin@@GLIBC_2.0luaD_growstackluaL_optnumberlua_rawgeti__modsi3strncpy@@GLIBC_2.0fopen@@GLIBC_2.1_setjmp@@GLIBC_2.0luaopen_math__strtoul_internal@@GLIBC_2.0luaL_typerror_IO_stdin_usedlua_rawsetluaK_codeluaL_prepbufferluaK_concatluaL_checktypesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0luaZ_init__data_startsin@@GLIBC_2.0lua_getlocal_IO_getc@@GLIBC_2.0lua_tobooleanlua_typenamelua_dofilelua_getfenvrand@@GLIBC_2.0lua_isuserdatalog@@GLIBC_2.0luaO_nilobjectlua_rawequalluaX_lexluaL_loadfileluaopen_loadlibluaK_posfixluaC_link__gmon_start__ceil@@GLIBC_2.0ldexp@@GLIBC_2.0